PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4909s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 739aa    MW: 81071.3 Da    PI: 6.9826
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4909s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095135501954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Cagra.4909s0013.1.p 513 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 550
                          664459******************************88 PP

2BELL121.34e-39371442172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r e+q++k+kLl++leeVd+rY++y+eq+q+v++sF++v+g g+a pYt+lA+ka+SrhFrcLkda+a q+
  Cagra.4909s0013.1.p 371 DRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDVVMGQGAALPYTALAQKAMSRHFRCLKDAVAAQL 442
                          589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-76301440IPR006563POX domain
PfamPF075262.9E-49306439IPR006563POX domain
PROSITE profilePS5007112.568491554IPR001356Homeobox domain
SMARTSM003891.2E-9494558IPR001356Homeobox domain
CDDcd000861.72E-12494555No hitNo description
SuperFamilySSF466893.34E-17496561IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-29497560IPR009057Homeodomain-like
PfamPF059203.7E-18511550IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MGIAKTSSSS TCTILLKTLH NNSMSQDYHH QGGVFSFSNG FDRSDSPSLI THQKQEHQRV  60
EEMDEESSVA GGGIPVYETA GMLSEMFNFP GGSRGGRDLD HGQSFRSNRQ LLEEQHQNIP  120
ALNDSATATA AAMQLFLMNP PPPHQQQPPS PSSTSTTRSH HNSSTLHMLL PNPSTNTTHH  180
QSYDNNMSMH QQLPHHHNHQ QLTWQSSSSD HHHNSQTEIG TIHVENSGGQ GLSLSLSSSL  240
EAAAKAEEYR NIYYGANPSN ASPHHQYNQF KTLLANSSQH HQVLNQFRPS PTVAAASSSS  300
IGAVNILRHS RYTTSAQELL EEFCSVGRGF LKKNKQKNNS NPNASGGDGG GGSSPSSAGA  360
IKDHPTLSAS DRIEHQRRKV KLLTMLEEVD RRYNHYCEQM QMVVNSFDVV MGQGAALPYT  420
ALAQKAMSRH FRCLKDAVAA QLKQSCELLG DKDGAGMSSS GLTKGETPRL RLLEQSLRQQ  480
RAFHQMGMME QEAWRPQRGL PERSVNILRA WLFEHFLHPY PSDADKHLLA RQTGLSRNQV  540
SNWFINARVR LWKPMVEEMY QQESKERERE RERERDQEGL EGNEDDQETK NSNNDKSTKP  600
NDNNESNFTA ARTTSSQTPI TTAPDAAAVA TGHRLRSDIN AYENDPSSLL LPSSYSNAAA  660
AASADLGSRY GGGSAAFSAV ATCQQGVGGF VDADMAGVNV IRFGTNPTGD VSLTLGLRHA  720
GNMPDKDPSF CVRDFGGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16500558563Homeobox protein Meis2
3k2a_B1e-16500558563Homeobox protein Meis2
4xrs_A9e-17500557158Homeobox protein Meis1
4xrs_B9e-17500557158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1738160.0AF173816.1 Arabidopsis thaliana bel1-like homeodomain 2 (BLH2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283201.10.0hypothetical protein CARUB_v10004235mg
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLR0GH260.0R0GH26_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70003080.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.20.0BEL1-like homeodomain 2